PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g059310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 1979aa    MW: 218082 Da    PI: 7.1699
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g059310.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.72e-11807848346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e++++  + +G++ +k+Ia+++   +t  +c+++++k
   Csa09g059310.1 807 PWTSEEKEIFLKMLASHGKD-FKKIASYLS-QKTTADCVDYYYK 848
                      8*****************99.*********.9**********98 PP

2Myb_DNA-binding35.72e-1112071248346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                       +WT eE e++++  + +G++ +k+Ia+++   +t  +c+++++k
   Csa09g059310.1 1207 PWTSEEKEIFLKMLASHGKD-FKKIASYLS-QKTTADCVDYYYK 1248
                       8*****************99.*********.9**********98 PP

3Myb_DNA-binding26.81.2e-0814221463447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   +++++ ++G++ +++I+r++g  R++ qc+ ++ k+
   Csa09g059310.1 1422 WTDDERSAFIQGFSLFGKN-FASISRYVG-SRSPDQCRVFFSKV 1463
                       *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-14790851IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-7799850IPR009057Homeodomain-like
PROSITE profilePS5129315.096803854IPR017884SANT domain
SMARTSM007175.2E-10804852IPR001005SANT/Myb domain
CDDcd001672.62E-8807849No hitNo description
PfamPF002498.5E-9807848IPR001005SANT/Myb domain
SuperFamilySSF466891.79E-1411901251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-711991250IPR009057Homeodomain-like
PROSITE profilePS5129315.09612031254IPR017884SANT domain
SMARTSM007175.2E-1012041252IPR001005SANT/Myb domain
PfamPF002498.5E-912071248IPR001005SANT/Myb domain
CDDcd001672.62E-812071249No hitNo description
PROSITE profilePS5129312.514171468IPR017884SANT domain
SMARTSM007176.0E-814181466IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-414211462IPR009057Homeodomain-like
SuperFamilySSF466892.96E-914211468IPR009057Homeodomain-like
CDDcd001671.10E-614221463No hitNo description
PfamPF002494.9E-714221462IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1979 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHD RPEPSSFDSP FRWRDSPSST PSSHHVPREF SRWGSGGDFR  60
RPSSSSSSCH GKQGGRHQFA EESSHGYTSS RSSARIFDND YYRPSASRGD WRYTRNCRDD  120
RVSVSQKEWK CNTWEMSNGS SRSFERPFGI RNGRRSVDER PLHASDTHTT AVNSFDPTNS  180
AHQPDTEVYT PVRSLKFKSE QKFSDQRLSL PSDPHSDCVS LFERPSSENN YGSKVSSPAK  240
QCNDLMYGRR IANDNSLDPP ILNAELEGTW EQPHMKDPQE DNRLHGDATA CATTTHLSEE  300
MSSRKKQRLG WGEGLAKYEK KRVDVNTNED GTTLLENGSE ELHSLNKSIA DKSPTAATVP  360
DYGSPTTPSS VACSSSPGFA DKSSAKAAIA GCDVSDMCRS PSPVSSFHLE QFPINIEELD  420
NILMERFGCL LNELLCTDDP GTGDSSSVQL TSMNRLLSWK SEILKAVEMT ESEIDLLENK  480
HRALKLEGER HCHVVGPSSH FCEGDANVPK EKEASCILGP KVAAPCVAET LVRSPVHQSG  540
LAKVPVDVFE DNPGEVKSLS QSFATVESNE DLLPMTSMKA AASSKEINTP AFVSQETIEL  600
SAAADSMASN EDLLCATLYS SNKKYACESS GVFNELLPRN FCSFDDSRFP SICHTQFDSH  660
VKEKIADRVE LLRAREKILL LQFKAFQLSW KKDLHQLAST KYQSKSSKKT ELYPNAKNGG  720
YLKLPQPVRL RFSSSAPRRD SVVPTTELVS YMEKLLPGTH LKPIRDILRM PAMILDEKER  780
VMSRFISSNG LVEDPCDVEK ERTMINPWTS EEKEIFLKML ASHGKDFKKI ASYLSQKTTA  840
DCVDYYYKNH KSDCFGKIKK QRAYGKEGKH TYMLAPRKKW KREMGSASLE ILGAVSVVAA  900
NAGKGDANVP KEKEASCILG PKVAAPSVAE SLVRSPVHQS GLAKVPDVFE DNPGEVKSLS  960
QSFATVESNE DLLPMPSMKA AGSSKEINTP AFVNPETIEL SAADDSMASN VDLLCATLYS  1020
SNKKYACESS GVFNELLPRN FCSFDDSRFP SICHTQFDSH VKEKIADRVE LLRAREKILL  1080
LQFKAFQLSW KKDLHQLAST KYQSKSSKKT ELYPNAKNGG YLKLPQPVRL RFSSSAPRRD  1140
SVVPTTELVS YMEKLLPGTH LKPIRDILRM PAMILDEKER VISRFISSNG LVEDPCDVEK  1200
ERTMINPWTS EEKEIFLKML ASHGKDFKKI ASYLSQKTTA DCVDYYYKNH KSDCFGKIKK  1260
QRAYGKEGKH TYMLAPRKKW KREMGSASLE ILGAVSVVAA NAGKVAPTRP ITSKRITLRG  1320
CSSSNSLQHD GNNSEGCSYS FDFPRKRTVG ADVLAVGPLS SEQINSCLRT SVSSRERCMD  1380
HLKFNPVVKK PRISHTLHNE NSNEEDDSCS EESCGETGPI HWTDDERSAF IQGFSLFGKN  1440
FASISRYVGS RSPDQCRVFF SKVRKCLGLE FIQSGSGNVS TSVSVDNGNE GGGSDLEDPC  1500
PIESNSGICT KMDMNSPTSP FNMNQDGANH SGSANVKADL SRSEQENGLT YMQDGSNPVN  1560
NAYINGGLPG LISESCRDLV DINTVESQSQ AAGKSKSNDL LSMEIDEGVL TSVAVYSEPL  1620
YCGLSVLSNV IVETPAESSG DQGSAIPKLS SKNQDGVMQA ANRTRNSGLE PESAPSGFKY  1680
PECLHHVPIE VCTENPIGVS VPRGNPNCHT EGKSGHSLVG QAVETHDLGW QSSKDNLEFD  1740
RQLQVIGHVN PEQNGHLNAN YAESCQIPQR SVIQDPSRIS RSKSDLIVKA QRTCEGFSLI  1800
KCTSSAPNPL AVSHKEGRSG HSRSHSFSLS DTERLDKNGD VKLFGTVLTA DENGIKQKHN  1860
PCGSVRSSST LSRDHDTRHH CINQQHLQNV PITSYGFWDG NRIQTGLTSL PESAKLLASC  1920
PEAFSSHLKQ QVGKEIRLDV NGGGILSFGK LNEDRAEASS AKDGGNIGGV NGVAEAAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-167641255393NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-167641255393NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5469830.0HF546983.1 Arabis alpina myb gene for myb like transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431268.10.0PREDICTED: uncharacterized protein LOC104715571
TrEMBLD7LU400.0D7LU40_ARALL; Myb family transcription factor
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein